PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Traes_2AL_1B43EA59E.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family WRKY
Protein Properties Length: 228aa    MW: 24736.7 Da    PI: 9.5862
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Traes_2AL_1B43EA59E.1genomeIWGSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY104.84.5e-3369126259
                            --SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
                   WRKY   2 dDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                            +Dgy+WrKYGqK vk+s+fprsYYrCt ++C+vkk+vers++dp+vv++tYeg+H h+
  Traes_2AL_1B43EA59E.1  69 EDGYRWRKYGQKAVKNSPFPRSYYRCTNNKCTVKKRVERSSDDPSVVITTYEGQHCHH 126
                            8******************************************************997 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.20.25.801.8E-3353127IPR003657WRKY domain
SuperFamilySSF1182901.57E-2860126IPR003657WRKY domain
PROSITE profilePS5081129.52863128IPR003657WRKY domain
SMARTSM007748.4E-3968127IPR003657WRKY domain
PfamPF031062.9E-2669126IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 228 aa     Download sequence    Send to blast
MEGAGASSSS TDDGATREAA DADGRPAAAT EAASKPAPAP APGKTMKKQK RARHPRFAFM  60
TKTEIDHLED GYRWRKYGQK AVKNSPFPRS YYRCTNNKCT VKKRVERSSD DPSVVITTYE  120
GQHCHHTVTF PRGAGAATLA SQMAFSAHHH HHLMYNDLPA LHSPTTQNPL FSVPAMSSSL  180
LQPLHCNRQE LQVASYTTQA SSISSPGSVP AVDKGLLDDM VPPAMRHG
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
2lex_A2e-2658125774Probable WRKY transcription factor 4
1wj2_A2e-2658125774Probable WRKY transcription factor 4
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK2409582e-77AK240958.1 Oryza sativa Japonica Group cDNA, clone: J065045F23, full insert sequence.
GenBankAY3418582e-77AY341858.1 Oryza sativa (japonica cultivar-group) WRKY18 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010228460.11e-83PREDICTED: probable WRKY transcription factor 57
TrEMBLW5AQ061e-171W5AQ06_WHEAT; Uncharacterized protein
STRINGMLOC_58026.21e-149(Hordeum vulgare)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP21253796
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G69310.22e-55WRKY DNA-binding protein 57
Publications ? help Back to Top
  1. Brenchley R, et al.
    Analysis of the bread wheat genome using whole-genome shotgun sequencing.
    Nature, 2012. 491(7426): p. 705-10
    [PMID:23192148]